Privacy Policy
When accessing our Website, alaskamedicalmalpracticelawyer.com will learn certain information about you during your visit. How we will handle information we learn about you depends upon what you do when visiting our site.
If you visit our site to read or download information on our pages, we collect and store only the following information about you:
- The name of the domain from which you access the Internet
- The date and time you access our site
- The Internet address of the website you used to link directly to our site.
- We do not share information. We simply pass on customer data to the advertisers
If you identify yourself by sending us an e-mail containing personal information, then the information collected will be solely used to respond to your message. The information collected is for statistical purposes. alaskamedicalmalpracticelawyer.com may use software programs to create summary statistics, which are used for such purposes as assessing the number of visitors to the different sections of our site, what information is of most and least interest, determining technical design specifications, and identifying system performance or problem areas. For site security purposes and to ensure that this service remains available to all users, alaskamedicalmalpracticelawyer.com uses software programs to monitor network traffic to identify unauthorized attempts to upload or change information, or otherwise cause damage. alaskamedicalmalpracticelawyer.com will not obtain personally-identifying information about you when you visit our site, unless you choose to provide such information to us, nor will such information be sold or otherwise transferred to unaffiliated third parties without the approval of the user at the time of collection
Third Party Advertising
The ads appearing on this Web site are delivered to users by our Web advertising partners. Our Web advertising partners may set cookies. Doing this allows the ad network to recognize your computer each time they send you an online advertisement. In this way, ad networks may compile information about where you, or others who are using your computer, saw their advertisements and determine which ads are clicked on. This information allows an ad network to deliver targeted advertisements that they believe will be of most interest to you. We do not have access to or control of the cookies that may be placed by the third-party ad servers or ad networks.
This privacy statement covers the use of cookies by our site and does not cover the use of cookies by any advertiser.
alaskamedicalmalpracticelawyer.com allows Magnetic to monitor alaskamedicalmalpracticelawyer.com affiliated sites for the purpose of reporting website traffic, statistics, advertisements, “click-throughs” and/or other activities, and such Magnetic may use cookies, web beacons and other monitoring technologies to compile anonymous statistics about alaskamedicalmalpracticelawyer.com users.
For further information about Magnetic's search re-targeting product, Magnetic’s homepage on the Web is located at http://www.magnetic.is. The full text of Magnetic’s privacy policy is available on the Web at http://privacy.magnetic.is. Magnetic may allow third parties to monitor Magnetic associated sites for the purpose of reporting website traffic, statistics, advertisements, “click-throughs” and/or other activities, and such third parties may use cookies, web beacons and other monitoring technologies to compile anonymous statistics about Magnetic users.
Users may go to http://magnetic.is for information on what is being tracked. Users may go to http://privacy.magnetic.is/w3c/optout.html for information on how to opt-in or opt-out of use of their information by Magnetic and may go to http://www.networkadvertising.org/managing/opt_out.asp to opt-out of most third party tracking.